Paralogue Annotation for RYR1 residue 590

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 590
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 590

No paralogue variants have been mapped to residue 590 for RYR1.



RYR1LEVLYCVLIESPEVLNIIQENHIKSIISLL>D<KHGRNHKVLDVLCSLCVCNGVAVRSNQDLI620
RYR2LEVLHCVLVESPEALNIIKEGHIKSIISLL>D<KHGRNHKVLDVLCSLCVCHGVAVRSNQHLI632
RYR3LEVLHCILTESPEALNLIAEGHIKSIISLL>D<KHGRNHKVLDILCSLCLCNGVAVRANQNLI619
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D590Yc.1768G>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging