Paralogue Annotation for RYR1 residue 626

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 626
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 626

No paralogue variants have been mapped to residue 626 for RYR1.



RYR1HKVLDVLCSLCVCNGVAVRSNQDLITENLL>P<GRELLLQTNLINYVTSIRPNIFVGRAEGTT656
RYR2HKVLDVLCSLCVCHGVAVRSNQHLICDNLL>P<GRDLLLQTRLVNHVSSMRPNIFLGVSEGSA668
RYR3HKVLDILCSLCLCNGVAVRANQNLICDNLL>P<RRNLLLQTRLINDVTSIRPNIFLGVAEGSA655
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P626Rc.1877C>G Putative Benignrs140133838SIFT:
Polyphen: probably damaging