Paralogue Annotation for RYR1 residue 654

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 654
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 654

No paralogue variants have been mapped to residue 654 for RYR1.



RYR1LLPGRELLLQTNLINYVTSIRPNIFVGRAE>G<TTQYSKWYFEVMVDEVTPFLTAQATHLRVG684
RYR2LLPGRDLLLQTRLVNHVSSMRPNIFLGVSE>G<SAQYKKWYYELMVDHTEPFVTAEATHLRVG696
RYR3LLPRRNLLLQTRLINDVTSIRPNIFLGVAE>G<SAQYKKWYFELIIDQVDPFLTAEPTHLRVG683
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G654Dc.1961G>A Putative BenignSIFT:
Polyphen: possibly damaging