Paralogue Annotation for RYR1 residue 727

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 727
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 727

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2R739HCatecholaminergic polymorphic ventricular tachycarHigh8 19926015, 24025405

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1AGEGWGGNGVGDDLYSYGFDGLHLWTGHVA>R<PVTSPGQHLLAPEDVISCCLDLSVPSISFR757
RYR2GGEEWGGNGVGDDLFSYGFDGLHLWSGCIA>R<TVSSPNQHLLRTDDVISCCLDLSAPSISFR769
RYR3GGEGWGGNGVGDDLYSYGFDGLHLWSGRIP>R<AVASINQHLLRSDDVVSCCLDLGVPSISFR756
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R727Hc.2180G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging
p.R727Cc.2179C>T Putative BenignSIFT:
Polyphen: