Paralogue Annotation for RYR1 residue 735

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 735
Reference Amino Acid: H - Histidine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 735

No paralogue variants have been mapped to residue 735 for RYR1.



RYR1GVGDDLYSYGFDGLHLWTGHVARPVTSPGQ>H<LLAPEDVISCCLDLSVPSISFRINGCPVQG765
RYR2GVGDDLFSYGFDGLHLWSGCIARTVSSPNQ>H<LLRTDDVISCCLDLSAPSISFRINGQPVQG777
RYR3GVGDDLYSYGFDGLHLWSGRIPRAVASINQ>H<LLRSDDVVSCCLDLGVPSISFRINGQPVQG764
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.H735Yc.2203C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Expanding genotype/phenotype of neuromuscular diseases by comprehensive target capture/NGS. Neurol Genet. 2015 1(2):e14. doi: 10.1212/NXG.0000000000000015. eColl 27066551