Paralogue Annotation for RYR1 residue 750

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 750
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 750

No paralogue variants have been mapped to residue 750 for RYR1.



RYR1LWTGHVARPVTSPGQHLLAPEDVISCCLDL>S<VPSISFRINGCPVQGVFESFNLDGLFFPVV780
RYR2LWSGCIARTVSSPNQHLLRTDDVISCCLDL>S<APSISFRINGQPVQGMFENFNIDGLFFPVV792
RYR3LWSGRIPRAVASINQHLLRSDDVVSCCLDL>G<VPSISFRINGQPVQGMFENFNTDGLFFPVM779
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S750Gc.2248A>G Putative BenignSIFT:
Polyphen: probably damaging