Paralogue Annotation for RYR1 residue 759

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 759
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 759

No paralogue variants have been mapped to residue 759 for RYR1.



RYR1VTSPGQHLLAPEDVISCCLDLSVPSISFRI>N<GCPVQGVFESFNLDGLFFPVVSFSAGVKVR789
RYR2VSSPNQHLLRTDDVISCCLDLSAPSISFRI>N<GQPVQGMFENFNIDGLFFPVVSFSAGIKVR801
RYR3VASINQHLLRSDDVVSCCLDLGVPSISFRI>N<GQPVQGMFENFNTDGLFFPVMSFSAGVKVR788
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N759Dc.2275A>G Other MyopathySIFT:
Polyphen: probably damaging
ReportsOther Myopathy Severe congenital RYR1-associated myopathy: the expanding clinicopathologic and genetic spectrum. Neurology. 2013 80(17):1584-9. doi: 10.1212/WNL.0b013e3182900380. 23553484
Other Myopathy Genotype-phenotype correlations in recessive RYR1-related myopathies. Orphanet J Rare Dis. 2013 8:117. doi: 10.1186/1750-1172-8-117. 23919265
Other Myopathy Using exome data to identify malignant hyperthermia susceptibility mutations. Anesthesiology. 2013 119(5):1043-53. doi: 10.1097/ALN.0b013e3182a8a8e7. 24195946
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381
Other Myopathy Identification of Medically Actionable Secondary Findings in the 1000 Genomes. PLoS One. 2015 10(9):e0135193. doi: 10.1371/journal.pone.0135193. 26332594