Paralogue Annotation for RYR1 residue 818

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 818
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 818

No paralogue variants have been mapped to residue 818 for RYR1.



RYR1VRFLLGGRHGEFKFLPPPGYAPCHEAVLPR>E<RLHLEPIKEYRREGPRGPHLVGPSRCLSHT848
RYR2VRFLLGGRHGEFKFLPPPGYAPCYEAVLPK>E<KLKVEHSREYKQERTYTRDLLGPTVSLTQA860
RYR3VRFLMGGRHGEFKFLPPSGYAPCYEALLPK>E<KMRLEPVKEYKRDADGIRDLLGTTQFLSQA847
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E818Ac.2453A>C Putative BenignSIFT: tolerated
Polyphen: possibly damaging