Paralogue Annotation for RYR1 residue 834

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 834
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 834

No paralogue variants have been mapped to residue 834 for RYR1.



RYR1PPGYAPCHEAVLPRERLHLEPIKEYRREGP>R<GPHLVGPSRCLSHTDFVPCPVDTVQIVLPP864
RYR2PPGYAPCYEAVLPKEKLKVEHSREYKQERT>Y<TRDLLGPTVSLTQAAFTPIPVDTSQIVLPP876
RYR3PSGYAPCYEALLPKEKMRLEPVKEYKRDAD>G<IRDLLGTTQFLSQASFIPCPVDTSQVILPP863
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R834Wc.2500C>T Putative BenignSIFT:
Polyphen: possibly damaging