Paralogue Annotation for RYR1 residue 838

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 838
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 838

No paralogue variants have been mapped to residue 838 for RYR1.



RYR1APCHEAVLPRERLHLEPIKEYRREGPRGPH>L<VGPSRCLSHTDFVPCPVDTVQIVLPPHLER868
RYR2APCYEAVLPKEKLKVEHSREYKQERTYTRD>L<LGPTVSLTQAAFTPIPVDTSQIVLPPHLER880
RYR3APCYEALLPKEKMRLEPVKEYKRDADGIRD>L<LGTTQFLSQASFIPCPVDTSQVILPPHLEK867
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L838Pc.2513T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145