Paralogue Annotation for RYR1 residue 841

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 841
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 841

No paralogue variants have been mapped to residue 841 for RYR1.



RYR1HEAVLPRERLHLEPIKEYRREGPRGPHLVG>P<SRCLSHTDFVPCPVDTVQIVLPPHLERIRE871
RYR2YEAVLPKEKLKVEHSREYKQERTYTRDLLG>P<TVSLTQAAFTPIPVDTSQIVLPPHLERIRE883
RYR3YEALLPKEKMRLEPVKEYKRDADGIRDLLG>T<TQFLSQASFIPCPVDTSQVILPPHLEKIRD870
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P841Lc.2522C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging