Paralogue Annotation for RYR1 residue 846

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 846
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 846

No paralogue variants have been mapped to residue 846 for RYR1.



RYR1PRERLHLEPIKEYRREGPRGPHLVGPSRCL>S<HTDFVPCPVDTVQIVLPPHLERIREKLAEN876
RYR2PKEKLKVEHSREYKQERTYTRDLLGPTVSL>T<QAAFTPIPVDTSQIVLPPHLERIREKLAEN888
RYR3PKEKMRLEPVKEYKRDADGIRDLLGTTQFL>S<QASFIPCPVDTSQVILPPHLEKIRDRLAEN875
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S846Lc.2537C>T Putative BenignSIFT:
Polyphen: possibly damaging