Paralogue Annotation for RYR1 residue 883

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 883
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 883

No paralogue variants have been mapped to residue 883 for RYR1.



RYR1CPVDTVQIVLPPHLERIREKLAENIHELWA>L<TRIEQGWTYGPVRDDNKRLHPCLVDFHSLP913
RYR2IPVDTSQIVLPPHLERIREKLAENIHELWV>M<NKIELGWQYGPVRDDNKRQHPCLVEFSKLP925
RYR3CPVDTSQVILPPHLEKIRDRLAENIHELWG>M<NKIELGWTFGKIRDDNKRQHPCLVEFSKLP912
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L883Qc.2648T>A Putative BenignSIFT: deleterious
Polyphen: probably damaging