Paralogue Annotation for RYR1 residue 933

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 933
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 933

No paralogue variants have been mapped to residue 933 for RYR1.



RYR1HPCLVDFHSLPEPERNYNLQMSGETLKTLL>A<LGCHVGMADEKAEDNLKKTKLPKTYMMSNG963
RYR2HPCLVEFSKLPEQERNYNLQMSLETLKTLL>A<LGCHVGISDEHAEDKVKKMKLPKNYQLTSG975
RYR3HPCLVEFSKLPETEKNYNLQMSTETLKTLL>A<LGCHIAHVNPAAEEDLKKVKLPKNYMMSNG962
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A933Tc.2797G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy The ryanodine receptor type 1 gene variants in African American men with exertional rhabdomyolysis and malignant hyperthermia susceptibility. Clin Genet. 2009 76(6):564-8. 19807743
Other Myopathy Actionable, pathogenic incidental findings in 1,000 participants' exomes. Am J Hum Genet. 2013 93(4):631-40. doi: 10.1016/j.ajhg.2013.08.006. 24055113
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381