Paralogue Annotation for RYR1 residue 938

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 938
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 938

No paralogue variants have been mapped to residue 938 for RYR1.



RYR1DFHSLPEPERNYNLQMSGETLKTLLALGCH>V<GMADEKAEDNLKKTKLPKTYMMSNGYKPAP968
RYR2EFSKLPEQERNYNLQMSLETLKTLLALGCH>V<GISDEHAEDKVKKMKLPKNYQLTSGYKPAP980
RYR3EFSKLPETEKNYNLQMSTETLKTLLALGCH>I<AHVNPAAEEDLKKVKLPKNYMMSNGYKPAP967
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V938Mc.2812G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging