Paralogue Annotation for RYR1 residue 977

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 977
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 977

No paralogue variants have been mapped to residue 977 for RYR1.



RYR1DNLKKTKLPKTYMMSNGYKPAPLDLSHVRL>T<PAQTTLVDRLAENGHNVWARDRVGQGWSYS1007
RYR2DKVKKMKLPKNYQLTSGYKPAPMDLSFIKL>T<PSQEAMVDKLAENAHNVWARDRIRQGWTYG1019
RYR3EDLKKVKLPKNYMMSNGYKPAPLDLSDVKL>L<PPQEILVDKLAENAHNVWAKDRIKQGWTYG1006
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T977Mc.2930C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging