Paralogue Annotation for RYR2 residue 118

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 118
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 118

No paralogue variants have been mapped to residue 118 for RYR2.



RYR2KSEGQVDVEKWKFMMKTAQGGGHRTLLYGH>A<ILLRHSYSGMYLCCLSTSRSSTDKLAFDVG148
RYR1AG--V---E-------SSQGGGHRTLLYGH>A<ILLRHAHSRMYLSCLTTSRSMTDKLAFDVG135
RYR3NG-GE---G-------AAQGGGHRTLLYGH>A<VLLRHSFSGMYLTCLTTSRSQTDKLAFDVG138
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A118Vc.353C>T Putative BenignSIFT: deleterious
Polyphen: benign