Paralogue Annotation for RYR2 residue 1223

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1223
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1223

No paralogue variants have been mapped to residue 1223 for RYR2.



RYR2KDFDVGDGFIPVCSLGVAQVGRMNFGKDVS>T<LKYFTICGLQEGYEPFAVNTNRDITMWLSK1253
RYR1REIEIGDGFLPVCSLGPGQVGHLNLGQDVS>S<LRFFAICGLQEGFEPFAINMQRPVTTWFSK1239
RYR3ADYEIENGFVPICCLGLSQIGRMNLGTDAS>T<FKFYTMCGLQEGFEPFAVNMNRDVAMWFSK1239
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1223Ac.3667A>G Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT Gender Differences in the Inheritance Mode of RYR2 Mutations in Catecholaminergic Polymorphic Ventricular Tachycardia Patients. PLoS One. 2015 10(6):e0131517. doi: 10.1371/journal.pone.0131517. 26114861