Paralogue Annotation for RYR2 residue 1268

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1268
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1268

No paralogue variants have been mapped to residue 1268 for RYR2.



RYR2PFAVNTNRDITMWLSKRLPQFLQVPSNHEH>I<EVTRIDGTIDSSPCLKVTQKSFGSQNSNTD1298
RYR1PFAINMQRPVTTWFSKGLPQFEPVPLEHPH>Y<EVSRVDGTVDTPPCLRLTHRTWGSQNSLVE1284
RYR3PFAVNMNRDVAMWFSKRLPTFVNVPKDHPH>I<EVMRIDGTMDSPPCLKVTHKTFGTQNSNAD1284
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I1268Tc.3803T>C Inherited ArrhythmiaSIFT: deleterious
Polyphen: benign
ReportsInherited ArrhythmiaBrS Genetic Analysis of Arrhythmogenic Diseases in the Era of NGS: The Complexity of Clinical Decision-Making in Brugada Syndrome. PLoS One. 2015 10(7):e0133037. doi: 10.1371/journal.pone.0133037. 26230511
p.I1268Vc.3802A>G Putative BenignSIFT:
Polyphen: