Paralogue Annotation for RYR2 residue 1295

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1295
Reference Amino Acid: S - Serine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1295

No paralogue variants have been mapped to residue 1295 for RYR2.



RYR2HEHIEVTRIDGTIDSSPCLKVTQKSFGSQN>S<NTDIMFYRLSMPIECAEVFSKTV-AGGLPG1324
RYR1HPHYEVSRVDGTVDTPPCLRLTHRTWGSQN>S<LVEMLFLRLSLPVQFHQHFRCTAGATPLAP1311
RYR3HPHIEVMRIDGTMDSPPCLKVTHKTFGTQN>S<NADMIYCRLSMPVECHSSFSH---------1302
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1295Gc.3883A>G Putative BenignSIFT: tolerated
Polyphen: benign