Paralogue Annotation for RYR2 residue 1365

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1365
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1365

No paralogue variants have been mapped to residue 1365 for RYR2.



RYR2EDYDADSDFEVLMKTAHGHLVPDRVDKDKE>A<TKPEFNNHK--------------DYAQEKP1381
RYR1RAAEPDPDYENLRRSAGGWSEAENGKEGTA>K<EGAPGGTPQAGGEAQPARAENEKDATTEKN1383
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A1365Vc.4094C>T Putative BenignSIFT: tolerated
Polyphen: benign