Paralogue Annotation for RYR2 residue 1366

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1366
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1366

No paralogue variants have been mapped to residue 1366 for RYR2.



RYR2DYDADSDFEVLMKTAHGHLVPDRVDKDKEA>T<KPEFNNHK--------------DYAQEKP-1381
RYR1AAEPDPDYENLRRSAGGWSEAENGKEGTAK>E<GAPGGTPQAGGEAQPARAENEKDATTEKNK1384
RYR3------------------------------>-<------------------------------
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1366Ac.4096A>G Putative BenignSIFT: tolerated
Polyphen: benign
p.T1366Nc.4097C>A Putative BenignSIFT: tolerated
Polyphen: benign