Paralogue Annotation for RYR2 residue 1423

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1423
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1423

No paralogue variants have been mapped to residue 1423 for RYR2.



RYR2TKPDYSTSHSARLTEDVLADDRDDYDFLMQ>T<-STYYYSVRIFPGQEPANVWVGWITSDFHQ1452
RYR1MTQPPATPTLPRLPHDVVPADNRDDPEIIL>N<TTTYYYSVRVFAGQEPSCVWAGWVTPDYHQ1458
RYR3---------SPCLDSEAFQKRKQMQEILSH>T<TTQCYYAIRIFAGQDPSCVWVGWVTPDYHL1354
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1423Mc.4268C>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging