Paralogue Annotation for RYR2 residue 1461

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1461
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1461

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1K1467RMalignant hyperthermia equivocal with halotaneMedium6 20681998, 25637381

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2RIFPGQEPANVWVGWITSDFHQYDTGFDLD>R<VRTVTVTLGDEKGKVHESIKRSNCYMVCAG1491
RYR1RVFAGQEPSCVWAGWVTPDYHQHDMSFDLS>K<VRVVTVTMGDEQGNVHSSLKCSNCYMVWGG1497
RYR3RIFAGQDPSCVWVGWVTPDYHLYSEKFDLN>K<NCTVTVTLGDERGRVHESVKRSNCYMVWGG1393
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 1461 for RYR2.