Paralogue Annotation for RYR2 residue 1482

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1482
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1482

No paralogue variants have been mapped to residue 1482 for RYR2.



RYR2QYDTGFDLDRVRTVTVTLGDEKGKVHESIK>R<SNCYMVCAGESMSPGQ-G-RNNNGLEIGCV1510
RYR1QHDMSFDLSKVRVVTVTMGDEQGNVHSSLK>C<SNCYMVWGGDFVSPGQQGRISHTDLVIGCL1518
RYR3LYSEKFDLNKNCTVTVTLGDERGRVHESVK>R<SNCYMVWGGDIVASSQRSNRSNVDLEIGCL1414
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1482Hc.4445G>A Putative BenignSIFT: tolerated
Polyphen: benign
p.R1482Cc.4444C>T Putative BenignSIFT: tolerated
Polyphen: probably damaging