Paralogue Annotation for RYR2 residue 1509

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1509
Reference Amino Acid: C - Cysteine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1509

No paralogue variants have been mapped to residue 1509 for RYR2.



RYR2KRSNCYMVCAGESMSPGQ-G-RNNNGLEIG>C<VVDAASGLLTFIANGKELSTYYQVEPSTKL1539
RYR1KCSNCYMVWGGDFVSPGQQGRISHTDLVIG>C<LVDLATGLMTFTANGKESNTFFQVEPNTKL1547
RYR3KRSNCYMVWGGDIVASSQRSNRSNVDLEIG>C<LVDLAMGMLSFSANGKELGTCYQVEPNTKV1443
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C1509Wc.4527T>G Putative BenignSIFT: deleterious
Polyphen: probably damaging