Paralogue Annotation for RYR2 residue 1518

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1518
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1518

No paralogue variants have been mapped to residue 1518 for RYR2.



RYR2AGESMSPGQ-G-RNNNGLEIGCVVDAASGL>L<TFIANGKELSTYYQVEPSTKLFPAVFAQAT1548
RYR1GGDFVSPGQQGRISHTDLVIGCLVDLATGL>M<TFTANGKESNTFFQVEPNTKLFPAVFVLPT1556
RYR3GGDIVASSQRSNRSNVDLEIGCLVDLAMGM>L<SFSANGKELGTCYQVEPNTKVFPAVFLQPT1452
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L1518Fc.4552C>T Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT Gender Differences in the Inheritance Mode of RYR2 Mutations in Catecholaminergic Polymorphic Ventricular Tachycardia Patients. PLoS One. 2015 10(6):e0131517. doi: 10.1371/journal.pone.0131517. 26114861