Paralogue Annotation for RYR2 residue 152

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 152
Reference Amino Acid: D - Aspartate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 152

No paralogue variants have been mapped to residue 152 for RYR2.



RYR2RHSYSGMYLCCLSTSRSSTDKLAFDVGLQE>D<TTGEACWWTIHPASKQRSEGEKVRVGDDLI182
RYR1RHAHSRMYLSCLTTSRSMTDKLAFDVGLQE>D<ATGEACWWTMHPASKQRSEGEKVRVGDDII169
RYR3RHSFSGMYLTCLTTSRSQTDKLAFDVGLRE>H<ATGEACWWTIHPASKQRSEGEKVRIGDDLI172
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D152Nc.454G>A UnknownSIFT:
Polyphen:
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510