Paralogue Annotation for RYR2 residue 1585

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1585
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1585

No paralogue variants have been mapped to residue 1585 for RYR2.



RYR2FELGRIKNVMPLSAGLFKSEHKNPVPQCPP>R<LHVQFLSHVLWSRMPNQFLKVDVSRISERQ1615
RYR1FELGKQKNIMPLSAAMFQSERKNPAPQCPP>R<LEMQMLMPVSWSRMPNHFLQVETRRAGERL1623
RYR3FELGKLKNAMPLSAAIFRSEEKNPVPQCPP>R<LDVQTIQPVLWSRMPNSFLKVETERVSERH1519
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1585Cc.4753C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging