Paralogue Annotation for RYR2 residue 1614

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1614
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1614

No paralogue variants have been mapped to residue 1614 for RYR2.



RYR2PRLHVQFLSHVLWSRMPNQFLKVDVSRISE>R<QGWLVQCLDPLQFMSLHIPEENRSVDILEL1644
RYR1PRLEMQMLMPVSWSRMPNHFLQVETRRAGE>R<LGWAVQCQEPLTMMALHIPEENRCMDILEL1652
RYR3PRLDVQTIQPVLWSRMPNSFLKVETERVSE>R<HGWVVQCLEPLQMMALHIPEENRCVDILEL1548
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1614Sc.4840C>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging
p.R1614Cc.4840C>T Putative BenignSIFT: tolerated
Polyphen: probably damaging
p.R1614Hc.4841G>A Putative BenignSIFT:
Polyphen: