Paralogue Annotation for RYR2 residue 1682

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1682
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1682

No paralogue variants have been mapped to residue 1682 for RYR2.



RYR2KFHYHTLRLYSAVCALGNHRVAHALCSHVD>E<PQLLYAIENKYMPGLLRAGYYDLLIDIHLS1712
RYR1RFHSHTLRLYRAVCALGNNRVAHALCSHVD>Q<AQLLHALEDAHLPGPLRAGYYDLLISIHLE1720
RYR3RFHYHTLRLYSAVCALGNSRVAYALCSHVD>L<SQLFYAIDNKYLPGLLRSGFYDLLISIHLA1616
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1682Dc.5046A>C Putative BenignSIFT: tolerated
Polyphen: possibly damaging