Paralogue Annotation for RYR2 residue 1851

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1851
Reference Amino Acid: F - Phenylalanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1851

No paralogue variants have been mapped to residue 1851 for RYR2.



RYR2LIKLFYTLLIMGIFHNEDLKHILQLIEPSV>F<KEAATPEEESDTL--E-K---ELS----VD1871
RYR1VLKLVSTLLVMGIFGDEDVKQILKMIEPEV>F<TEEEEEEDEEEEGEEEDEEEKEEDEEETAQ1901
RYR3VLKLIGTLLVMGVFDDDDVRQILLLIDPSV>F<GEHSAGTEEGAEK--E-E---VTQ----VE1775
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F1851Lc.5553T>A Putative BenignSIFT: tolerated
Polyphen: probably damaging