Paralogue Annotation for RYR2 residue 189

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 189
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 189

No paralogue variants have been mapped to residue 189 for RYR2.



RYR2WWTIHPASKQRSEGEKVRVGDDLILVSVSS>E<RYLHLSYGNGSLHVDAAFQQTLWSVAPISS219
RYR1WWTMHPASKQRSEGEKVRVGDDIILVSVSS>E<RYLHLSTASGELQVDASFMQTLWNMNPICS206
RYR3WWTIHPASKQRSEGEKVRIGDDLILVSVSS>E<RYLHLSVSNGNIQVDASFMQTLWNVHPTCS209
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E189Dc.567A>T Inherited ArrhythmiaCPVTSIFT: tolerated
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Heart Rhythm 2006. Abstracts of the 27th Annual Meeting of the Heart Rhythm Society, Boston, Massachusetts, USA, May 17-20, 2006. Heart Rhythm. 2006 3(1 Suppl):S1-343. 16688893
Inherited ArrhythmiaCPVT Characterization of a novel mutation in the cardiac ryanodine receptor that results in catecholaminergic polymorphic ventricular tachycardia. Channels (Austin). 2010 4(4):302-10. 20676041
Inherited ArrhythmiaCPVT The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405