Paralogue Annotation for RYR2 residue 1894

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1894
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1894

No paralogue variants have been mapped to residue 1894 for RYR2.



RYR2---VDDAK-LQGAGEE--EAKGGKRPKEGL>L<QMKLPEPVKLQMCLLLQYLCDCQVRHRIEA1924
RYR1EETAQEKEDEEKEEEEAAEGEKEEGLEEGL>L<QMKLPESVKLQMCHLLEYFCDQELQHRVES1957
RYR3---VEEKA-VEAG-----EKAGKEAPVKGL>L<QTRLPESVKLQMCELLSYLCDCELQHRVEA1825
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L1894Ic.5680C>A Putative BenignSIFT: deleterious
Polyphen: possibly damaging
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510
p.Leu1894Phec.5680C>T UnknownSIFT:
Polyphen: