Paralogue Annotation for RYR2 residue 1922

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1922
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1922

No paralogue variants have been mapped to residue 1922 for RYR2.



RYR2GLLQMKLPEPVKLQMCLLLQYLCDCQVRHR>I<EAIVAFSDDFVAKLQDNQRFRYNEVMQALN1952
RYR1GLLQMKLPESVKLQMCHLLEYFCDQELQHR>V<ESLAAFAERYVDKLQANQRSRYGLLIKAFS1985
RYR3GLLQTRLPESVKLQMCELLSYLCDCELQHR>V<EAIVAFGDIYVSKLQANQKFRYNELMQALN1853
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I1922Vc.5764A>G Putative BenignSIFT: tolerated
Polyphen: benign