Paralogue Annotation for RYR2 residue 1980

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1980
Reference Amino Acid: K - Lysine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1980

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1K2013QMalignant hyperthermiaHigh9 20681998

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2ALNMSAALTARKTKEFRSPPQEQINMLLNF>K<D--DKSECPCPEEIRDQLLDFHEDLMTHCG2008
RYR1AFSMTAAETARRTREFRSPPQEQINMLLQF>K<DGTDEEDCPLPEEIRQDLLDFHQDLLAHCG2043
RYR3ALNMSAALTARKTKEFRSPPQEQINMLLNF>Q<L--GE-NCPCPEEIREELYDFHEDLLLHCG1908
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 1980 for RYR2.