Paralogue Annotation for RYR2 residue 2107

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2107
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2107

No paralogue variants have been mapped to residue 2107 for RYR2.



RYR2DPELVRAMFVLLHRQYDGIGGLVRALPKTY>T<INGVSVEDTINLLASLGQIRSLLSVRMGKE2137
RYR1SPELVRAMFSLLHRQYDGLGELLRALPRAY>T<ISPSSVEDTMSLLECLGQIRSLLIVQMGPQ2173
RYR3DSELVRMMFNLLRRQYDSIGELLQALRKTY>T<ISHTSVSDTINLLAALGQIRSLLSVRMGKE2035
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2107Mc.6320C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging