Paralogue Annotation for RYR2 residue 217

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 217
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 217

No paralogue variants have been mapped to residue 217 for RYR2.



RYR2SSERYLHLSYGNGSLHVDAAFQQTLWSVAP>I<SSGSEAAQGYLIGGDVLRLLHGHMDECLTV247
RYR1SSERYLHLSTASGELQVDASFMQTLWNMNP>I<CSR--CEEGFVTGGHVLRLFHGHMDECLTI232
RYR3SSERYLHLSVSNGNIQVDASFMQTLWNVHP>T<CSGSSIEEGYLLGGHVVRLFHGH-DECLTI236
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I217Vc.649A>G Inherited ArrhythmiaLQTSSIFT: tolerated
Polyphen: benign
ReportsInherited ArrhythmiaLQTS Cardiac channel molecular autopsy: insights from 173 consecutive cases of autopsy-negative sudden unexplained death referred for postmortem genetic testing. Mayo Clin Proc. 2012 87(6):524-39. doi: 10.1016/j.mayocp.2012.02.017. 22677073
Inherited ArrhythmiaLQTS New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
Inherited ArrhythmiaLQTS Evaluation of ACMG-Guideline-Based Variant Classification of Cancer Susceptibility and Non-Cancer-Associated Genes in Families Affected by Breast Cancer. Am J Hum Genet. 2016 98(5):801-17. doi: 10.1016/j.ajhg.2016.02.024. 27153395
CardiomyopathyARVD/C Arrhythmogenic right ventricular cardiomyopathy: implications of next-generation sequencing in appropriate diagnosis. Europace. 2016 27194543