Paralogue Annotation for RYR2 residue 2183

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2183
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2183

No paralogue variants have been mapped to residue 2183 for RYR2.



RYR2KVFYQHPNLMRALGMHETVMEVMVNVLGGG>E<SKEITFPKMVANCCRFLCYFCRISRQNQKA2213
RYR1KVFYQHPNLMRALGMHETVMEVMVNVLGGG>E<SKEIRFPKMVTSCCRFLCYFCRISRQNQRS2249
RYR3KVFYQHPNLMRVLGMHETVMEVMVNVLGT->E<KSQIAFPKMVASCCRFLCYFCRISRQNQKA2110
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2183Vc.6548A>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging
ReportsPutative Benign The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015