Paralogue Annotation for RYR2 residue 2205

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2205
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2205

No paralogue variants have been mapped to residue 2205 for RYR2.



RYR2MVNVLGGGESKEITFPKMVANCCRFLCYFC>R<ISRQNQKAMFDHLSYLLENSSVGLASPAMR2235
RYR1MVNVLGGGESKEIRFPKMVTSCCRFLCYFC>R<ISRQNQRSMFDHLSYLLENSGIG--L-GMQ2268
RYR3MVNVLGT-EKSQIAFPKMVASCCRFLCYFC>R<ISRQNQKAMFEHLSYLLENSSVGLASPSMR2132
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2205Hc.6614G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging