Paralogue Annotation for RYR2 residue 2213

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2213
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2213

No paralogue variants have been mapped to residue 2213 for RYR2.



RYR2ESKEITFPKMVANCCRFLCYFCRISRQNQK>A<MFDHLSYLLENSSVGLASPAMRGSTPLDVA2243
RYR1ESKEIRFPKMVTSCCRFLCYFCRISRQNQR>S<MFDHLSYLLENSGIG--L-GMQGSTPLDVA2276
RYR3EKSQIAFPKMVASCCRFLCYFCRISRQNQK>A<MFEHLSYLLENSSVGLASPSMRGSTPLDVA2140
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A2213Sc.6637G>T CardiomyopathyARVD/CSIFT:
Polyphen:
ReportsCardiomyopathyARVD/C Prevalence and significance of rare RYR2 variants in arrhythmogenic right ventricular cardiomyopathy/dysplasia: results of a systematic screening. Heart Rhythm. 2014 11(11):1999-2009. doi: 10.1016/j.hrthm.2014.07.020 25041964