Paralogue Annotation for RYR2 residue 2250

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2250
Reference Amino Acid: N - Asparagine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2250

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1N2283HMulti-minicore diseaseHigh9 16940308

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2YLLENSSVGLASPAMRGSTPLDVAAASVMD>N<NELALALREPDLEKVVRYLAGCGLQSCQML2280
RYR1YLLENSGIG--L-GMQGSTPLDVAAASVID>N<NELALALQEQDLEKVVSYLAGCGLQSCPML2313
RYR3YLLENSSVGLASPSMRGSTPLDVAASSVMD>N<NELALSLEEPDLEKVVTYLAGCGLQSCPML2177
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 2250 for RYR2.