Paralogue Annotation for RYR2 residue 2267

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2267
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2267

No paralogue variants have been mapped to residue 2267 for RYR2.



RYR2STPLDVAAASVMDNNELALALREPDLEKVV>R<YLAGCGLQSCQMLVSKGYPDIGWNPVEGER2297
RYR1STPLDVAAASVIDNNELALALQEQDLEKVV>S<YLAGCGLQSCPMLVAKGYPDIGWNPCGGER2330
RYR3STPLDVAASSVMDNNELALSLEEPDLEKVV>T<YLAGCGLQSCPMLLAKGYPDVGWNPIEGER2194
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2267Hc.6800G>A Other Cardiac PhenotypeSIFT: tolerated
Polyphen: probably damaging
ReportsOther Cardiac Phenotype A mechanism for sudden infant death syndrome (SIDS): stress-induced leak via ryanodine receptors. Heart Rhythm. 2007 4(6):733-9. 17556193
Other Cardiac Phenotype New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.R2267Cc.6799C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging