Paralogue Annotation for RYR2 residue 2303

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2303
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2303

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1R2336HMalignant hyperthermiaHigh9 16835904, 19191329, 19648156, 21455645, 23558838, 23736090
RYR1R2336CMyopathy, congenitalHigh9 21062345

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2GLQSCQMLVSKGYPDIGWNPVEGERYLDFL>R<FAVFCNGESVEENANVVVRLLIRRPECFGP2333
RYR1GLQSCPMLVAKGYPDIGWNPCGGERYLDFL>R<FAVFVNGESVEENANVVVRLLIRKPECFGP2366
RYR3GLQSCPMLLAKGYPDVGWNPIEGERYLSFL>R<FAVFVNSESVEENASVVVKLLIRRPECFGP2230
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 2303 for RYR2.