Paralogue Annotation for RYR2 residue 2312

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2312
Reference Amino Acid: S - Serine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2312

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1S2345TMalignant hyperthermiaHigh8 24433488, 26119398
RYR1S2345RMalignant hyperthermiaHigh8 25960145

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2SKGYPDIGWNPVEGERYLDFLRFAVFCNGE>S<VEENANVVVRLLIRRPECFGPALRGEGGNG2342
RYR1AKGYPDIGWNPCGGERYLDFLRFAVFVNGE>S<VEENANVVVRLLIRKPECFGPALRGEGGSG2375
RYR3AKGYPDVGWNPIEGERYLSFLRFAVFVNSE>S<VEENASVVVKLLIRRPECFGPALRGEGGNG2239
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 2312 for RYR2.