Paralogue Annotation for RYR2 residue 2365

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2365
Reference Amino Acid: N - Asparagine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2365

No paralogue variants have been mapped to residue 2365 for RYR2.



RYR2LRGEGGNGLLAAMEEAIKIAEDPSRDGPSP>N<S-GSSKTLDTEEEEDDTIHMGNAIMTFYSA2394
RYR1LRGEGGSGLLAAIEEAIRISEDPARDGPGI>R<RDRRREHFGEEPPEENRVHLGHAIMSFYAA2428
RYR3LRGEGGNGLLAAMQGAIKISENPALDLPSQ>G<Y-KREVSTGDDEEEEEIVHMGNAIMSFYSA2291
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N2365Sc.7094A>G Putative BenignSIFT: tolerated
Polyphen: benign
p.N2365Kc.7095T>G Putative BenignSIFT:
Polyphen: benign