Paralogue Annotation for RYR2 residue 2395

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2395
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2395

No paralogue variants have been mapped to residue 2395 for RYR2.



RYR2S-GSSKTLDTEEEEDDTIHMGNAIMTFYSA>L<IDLLGRCAPEMHLIHAGKGEAIRIRSILRS2425
RYR1RDRRREHFGEEPPEENRVHLGHAIMSFYAA>L<IDLLGRCAPEMHLIQAGKGEALRIRAILRS2459
RYR3Y-KREVSTGDDEEEEEIVHMGNAIMSFYSA>L<IDLLGRCAPEMHLIQTGKGEAIRIRSILRS2322
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L2395Mc.7183T>A Putative BenignSIFT: deleterious
Polyphen: probably damaging