Paralogue Annotation for RYR2 residue 2435

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2435
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2435

No paralogue variants have been mapped to residue 2435 for RYR2.



RYR2EMHLIHAGKGEAIRIRSILRSLIPLGDLVG>V<ISIAFQMPTIAKDGNVVEPDMSAGFCPDHK2465
RYR1EMHLIQAGKGEALRIRAILRSLVPLEDLVG>I<ISLPLQIPTLGKDGALVQPKMSASFVPDHK2499
RYR3EMHLIQTGKGEAIRIRSILRSLVPTEDLVG>I<ISIPLKLPSLNKDGSVSEPDMAANFCPDHK2362
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2435Fc.7303G>T Putative BenignSIFT: deleterious
Polyphen: probably damaging