Paralogue Annotation for RYR2 residue 2475

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2475
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2475

No paralogue variants have been mapped to residue 2475 for RYR2.



RYR2IAKDGNVVEPDMSAGFCPDHKAAMVLFLDR>V<YGIEVQDFLLHLLEVGFLPDLRAAASLDTA2505
RYR1LGKDGALVQPKMSASFVPDHKASMVLFLDR>V<YGIENQDFLLHVLDVGFLPDMRAAASLDTA2539
RYR3LNKDGSVSEPDMAANFCPDHKAPMVLFLDR>V<YGIKDQTFLLHLLEVGFLPDLRASASLDTV2402
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2475Fc.7423G>T Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Pathogenesis of unexplained drowning: new insights from a molecular autopsy. Mayo Clin Proc. 2005 80(5):596-600. 15887426
Inherited ArrhythmiaCPVT The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015
Inherited ArrhythmiaCPVT Heterogeneity of ryanodine receptor dysfunction in a mouse model of catecholaminergic polymorphic ventricular tachycardia. Circ Res. 2013 112(2):298-308. doi: 10.1161/CIRCRESAHA.112.274803 23152493
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405