Paralogue Annotation for RYR2 residue 2533

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2533
Reference Amino Acid: P - Proline
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2533

No paralogue variants have been mapped to residue 2533 for RYR2.



RYR2DTAALSATDMALALNRYLCTAVLPLLTRCA>P<LFAGTEHHASLIDSLLHTVYRLSKGCSLTK2563
RYR1DTATFSTTEMALALNRYLCLAVLPLITKCA>P<LFAGTEHRAIMVDSMLHTVYRLSRGRSLTK2597
RYR3DTVSLSTTEAALALNRYICSAVLPLLTRCA>P<LFAGTEHCTSLIDSTLQTIYRLSKGRSLTK2460
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P2533Lc.7598C>T Inherited ArrhythmiaBrSSIFT:
Polyphen:
ReportsInherited ArrhythmiaBrS Next generation sequencing challenges in the analysis of cardiac sudden death due to arrhythmogenic disorders. Electrophoresis. 2014 35(21-22):3111-6. doi: 10.1002/elps.201400148. 24981977